Abstract
Recessive dystrophic epidermolysis bullosa (RDEB) patients suffer from chronic and repeatedly infected wounds predisposing them to the development of aggressive and life-threatening skin cancer in these areas. Vitamin D3 is an often neglected but critical factor for wound healing. Intact skin possesses the entire enzymatic machinery required to produce active 1-alpha,25-dihydroxyvitamin D3 (calcitriol), underscoring its significance to proper skin function. Injury enhances calcitriol production, inducing the expression of calcitriol target genes including the antimicrobial peptide cathelicidin (hCAP18), an essential component of the innate immune system and an important wound healing factor. We found significantly reduced hCAP18 expression in a subset of RDEB keratinocytes which could be restored by calcipotriol treatment. Reduced scratch closure in RDEB cell monolayers was enhanced up to 2-fold by calcipotriol treatment, and the secretome of calcipotriol-treated cells additionally showed increased antimicrobial activity. Calcipotriol exhibited anti-neoplastic effects, suppressing the clonogenicity and proliferation of RDEB tumor cells. The combined wound healing, anti-microbial, and anti-neoplastic effects indicate that calcipotriol may represent a vital therapeutic option for RDEB patients which we could demonstrate in a single-patient observation study.
Similar content being viewed by others
Introduction
Epidermolysis bullosa (EB) refers to a group of rare inherited skin disorders characterized by skin fragility, blistering, and erosions following minor trauma. The underlying cause of EB lies within mutations that affect various genes crucial to the structural integrity of the dermoepidermal junction (DEJ)1. Recessive dystrophic epidermolysis bullosa (RDEB) is caused by mutations in COL7A1 which encodes for type VII collagen, the main component of anchoring fibrils that function to attach the epidermis to the underlying dermis2. Due to loss of functional type VII collagen, patients with RDEB suffer from chronic open wounds which are susceptible to microbial infections that further delay wound healing and promote ongoing inflammation (as reviewed in3). Additionally, >90% of RDEB patients develop an aggressive and life-threatening cutaneous squamous cell carcinoma at sites of chronic and long-term skin wounds, indicating that tumorigenesis is related to the pathology of RDEB4,5. Recently, it was demonstrated that innate immune sensing of microbial products promotes wounding- and inflammation-induced skin tumorigenesis6, highlighting that topical antimicrobials and local wound care are critically important in wound management and possibly cancer prevention in RDEB. Currently, no general “standard” therapy for the treatment of non-healing and severely infected wounds in RDEB exists, and every patient is treated on an individual basis7,8. Existing approaches all come with disadvantages. Antiseptic baths are time-consuming, exhausting, and painful, as all dressings must be carefully removed. Topical sulfonamides containing silver have questionable efficacy and are associated with potential silver toxicities9,10, and long-term application of antibiotic and antiseptic ointments risks the emergence of multiresistant bacterial strains11. Thus, alternative strategies to manage chronic and infected wounds in RDEB are needed.
Vitamin D3 is a factor that is often overlooked but is critical for proper wound healing and tissue repair. The skin serves as the primary source of vitamin D3 for the entire body. UVB radiation in sunlight triggers the synthesis of cholecalciferol, the inactive pro-form which enters the circulation and undergoes 2 further hydroxylation steps, first in the liver to generate 25-hydroxyvitamin D (25D3 or calcidiol), and finally in the kidneys to generate the active form 1-alpha,25-dihydroxyvitamin D3 (1,25(OH)2D3), also known as 1,25D3 or calcitriol. Of note, while other tissues and organs obtain active VD3 via the circulation, skin keratinocytes are unique in that they possess the entire enzymatic machinery required to produce active calcitriol, independent of renal and hepatic hydroxylation steps12. Calcitriol is a potent ligand for the vitamin D receptor (VDR), a transcription factor which mediates most of the physiological actions of this hormone. Keratinocytes also express VDR, enabling them to respond to the calcitriol they produce, and underscoring the importance of this signaling axis to proper skin function. Under homeostatic conditions, the calcitriol/VDR complex modulates the expression of genes involved in keratinocyte proliferation and differentiation, and the maintenance of barrier function12,13. Skin injury further enhances production of calcitriol, triggering the expression of VDR-target genes involved in wound healing, most notably the antimicrobial peptide cathelicidin (CAMP)14. In humans, CAMP (also known as hCAP18 or LL-37) is the sole member of the cathelicidin family of antimicrobial peptides (AMPs), evolutionary conserved molecules that form part of the innate immune system and serve as an important first line of defense against infections (as reviewed in15,16). hCAP18 is initially expressed as an inactive precursor protein that is processed by serine proteases to the bioactive LL-37 AMP which exhibits direct antibacterial, antiviral, and antifungal activity17,18. Additionally, LL-37 exerts other biological activities important for wound healing including modulation of innate and adaptive immune responses, and promoting neovascularization and cellular migration which enhances the re-epithelialization of healing skin19,20.
Taken together, vitamin D3 enables keratinocytes to recognize and respond to wounding and infection by enhancing antimicrobial defenses and initiating repair processes. These findings are relevant in the context of RDEB, as limited sun exposure due to wound dressings and reduced outdoor activity of patients could lead to a local vitamin D3 deficiency in the skin21. We propose that enhancing active vitamin D3 levels at sites of injury where it is needed could be beneficial to wound healing and control of infections in RDEB patients. Here we provide pre-clinical evidence that in vitro treatment of RDEB keratinocytes with the active vitamin D3 analog calcipotriol elicits wound healing effects and enhances local antimicrobial defense. Additionally, calcipotriol exhibited anti-neoplastic effects against RDEB tumor cells, underscoring its potential as a safe therapeutic option for managing non-healing wounds in this patient group.
Results
Low doses of calcipotriol do not inhibit cell proliferation of RDEB keratinocytes
To facilitate the translation of our findings into a clinical therapy for RDEB patients, we performed all our studies with the active vitamin D3 analog calcipotriol, as it represents the active ingredient in a topical ointment already approved and indicated in the treatment of psoriasis22. We reasoned that any evidence of efficacy we obtained from our preclinical studies could be used to support the future re-purposing of calcipotriol for off-label use in RDEB. Calcitriol and its analogs are known to inhibit cell proliferation23. In the context of psoriasis, calcipotriol at a concentration of ~121 µM (Psorcutan®, 50 µg/g) is used in part to combat the abnormal hyperproliferation of keratinocytes associated with this disorder. As inhibition of cell proliferation would be detrimental to wound healing, we first determined the effective concentration range of calcipotriol to be used in wound healing studies in RDEB. Normal human keratinocytes (NHK) and RDEB keratinocytes were treated for 72 hrs with increasing concentrations of calcipotriol and proliferation was measured by MTT assay. We observed that at the highest concentrations of 10–100 µM, calcipotriol was toxic to keratinocytes (Fig. 1a,b). However, at concentrations up to 1 µM, calcipotriol had no negative impact on cell proliferation. At a concentration of 100 nM, calcipotriol treatment even resulted in a statistically significant albeit small positive impact on proliferation in the two RDEB keratinocyte cell lines tested (Fig. 1a).
RDEB keratinocytes are responsive to calcipotriol
In order to provide evidence that calcipotriol treatment could have a clinical benefit in RDEB, we then investigated the responsiveness of 5 different RDEB keratinocyte cell lines to calcipotriol using induction of cathelicidin (henceforth referred to as hCAP18), a direct VDR-target gene, as a readout. We treated RDEB and NHK cell lines with increasing concentrations of calcipotriol and measured hCAP18 mRNA expression by sqRT-PCR 24 hrs later. Interestingly, we found that basal levels of hCAP18 were significantly lower in 3 out of 5 RDEB cell lines when compared to NHK (Fig. 2a). While calcipotriol treatment induced hCAP18 expression in a concentration-dependent manner in all cell lines tested (Fig. 2b), induction was most robust in RDEB-2 and -3, the two cell lines with the lowest basal hCAP18 expression in our study. In RDEB-2 cells, treatment with 100 nM calcipotriol led to a ~150–fold enhancement of hCAP18 expression (Fig. 2b, left panel), resulting in levels that are comparable to those of normal keratinocytes under basal (untreated) conditions (Fig. 2b, right panel). Treatment of cells with 1000 nM calcipotriol did not result in further significant increase compared to the 100 nM treatment concentration in most cell lines tested. Taken together with the proliferation data above, our results suggest an effective threshold treatment concentration of 100 nM calcipotriol in RDEB.
The increase in hCAP18 mRNA upon calcipotriol treatment translated into enhanced protein levels that could be observed after 48 hrs. RDEB-2 and -3 cells, as well as NHK, were cultured in the absence or presence of 100 nM calcipotriol. After 48 hrs, immunofluorescence and Western blot assays were performed using an antibody against hCAP18 (~18 kDa). Immunofluorescence microscopy revealed a robust induction of hCAP18 in RDEB-2 and -3 cells (Fig. 2c and Suppl. Fig. S1) following calcipotriol treatment. hCAP18 displayed the typical perinuclear localization already described for this protein24. Western blot also confirmed the upregulation of hCAP18 protein in response to calcipotriol treatment especially at higher concentrations (Fig. 2d). Thus, RDEB keratinocytes are responsive to calcipotriol treatment, upregulating hCAP18 expression accordingly.
Calcipotriol enhances wound closure in RDEB in vitro
LL-37, the active AMP processed from hCAP18, has been shown to mediate wound healing processes by stimulating re-epithelialization19. To evaluate the impact of calcipotriol on wound closure in RDEB we performed in vitro scratch assays in confluent monolayers of RDEB-2 and RDEB-3 cells, as these two lines demonstrated significant induction of hCAP18. Scratch closure, in the absence or presence of 100 nM calcipotriol, was assessed by live microscopy over a 48 hr period, and compared to the wild type NHK cell line. NHK typically achieved closure with a median time of about 24 hrs without treatment. Closure rates in untreated RDEB keratinocyte monolayers, however, varied from slightly delayed in RDEB-3 cells to significantly reduced in RDEB-2 keratinocytes. RDEB-3 showed 67.3 and 78% scratch closure after 24 and 48 hrs respectively in the absence of treatment, whereas RDEB-2 cells typically achieved only 16.2 and 20.5% closure at the same time points (Fig. 3a). Treatment with calcipotriol did not significantly enhance scratch closure further in either NHK or RDEB-3 keratinocytes (Suppl. Fig. S2). However, treatment of RDEB-2 keratinocytes with 100 nM calcipotriol, led to significantly enhanced wound closure rates of 1.9-fold over vehicle-treated controls at 24- and 48 hrs (Fig. 3b,c). Although cells were starved of growth factors during the 48-hour observation period, they were not mitotically inactivated prior to making the scratch. Therefore both ongoing cell proliferation and enhanced migration likely contributed to scratch closure in this assay. Importantly, both are physiological processes crucial for proper wound closure.
Calcipotriol enhances innate immune defense in RDEB
RDEB patients are susceptible to wound infections which in turn can hinder the healing process. In this respect, calcipotriol-mediated induction of hCAP18/LL-37 could impart a significant clinical benefit to patients by controlling infection. To investigate this, we established a resazurin-based antimicrobial assay to test the ability of a custom synthesized LL-37 peptide (0.5–10 µg/ml) to inhibit the growth of P. aeruginosa or C. albicans, both previously described as wound colonizers in EB25. Reduction of resazurin to the highly fluorescent resorufin served as an indicator of microbial viability and growth. Fluorescence readings were taken every hour for 24 hrs to evaluate microbial growth kinetics. While the viability of P. aeruginosa was unaffected under these assay conditions, inhibition of C. albicans by LL-37 was dose dependent and could readily be measured in our assay (Fig. 4a, left panel). We therefore used C. albicans as the target for subsequent investigation of the antimicrobial potential of the RDEB cell secretome upon calcipotriol treatment. NHK, RDEB-2, and RDEB-3 keratinocytes were treated for 48 hrs with 100 nM calcipotriol or the vehicle control and supernatants were harvested for co-incubation with C. albicans as described above. Notably, we observed reduced microbial growth when C. albicans was incubated with conditioned medium from calcipotriol-treated RDEB cells as compared to vehicle-treated cells (Fig. 4b). Incubation of C. albicans directly with 100 nM calcipotriol did not have any impact on its growth rate (Fig. 4a right panel). Thus, the observed anti-microbial effects were not directly caused by calcipotriol, but rather by a factor secreted by the treated cells, likely LL-37. In this regard we could confirm the secretion of cathelicidin into the cell culture medium of treated cells which was already detectable at 24 hrs by dot blot assays (Fig. 4c). These results demonstrate that treatment with calcipotriol can enhance the local antimicrobial defense of RDEB keratinocytes.
Anti-neoplastic effects of calcipotriol in RDEB-SCC
Vitamin D3 is reported to have anti-neoplastic effects26, which is an important consideration for RDEB patients who are prone to developing aggressive cutaneous squamous cell carcinoma (SCC) at sites of chronic wounding. We therefore investigated the effects of calcipotriol treatment on several patient-derived RDEB-SCC cell lines in clonogenicity and proliferation assays. Clonogenicity assays assess the reproductive integrity of cells, i.e. their ability to proliferate indefinitely, and are often used to evaluate the efficacy of chemotherapeutic agents against tumor cells27. RDEB-SCC cells, plated at a density of 3 cells per cm2 in 175 cm2 flasks, were cultured for up to 18 days in the absence or presence of 100 nM calcipotriol. We observed a striking inhibition in the growth of colonies (defined as >50 cells) in 2 tumor lines, RDEB-SCC1, and RDEB-SCC62, upon treatment with calcipotriol. A third SCC line did not form colonies in this assay and was not used further. Treatment with 100 nM calcipotriol resulted in a significant reduction in both number (Fig. 5a,b) and size (Fig. 5c,d) of tumor colonies as compared to vehicle-treated controls. Notably, this anti-neoplastic effect was mediated by calcipotriol independent of LL-37, as direct application of 500 ng/ml LL-37 peptide showed no effect on the clonogenic potential of these tumor cells (Fig. 5a,b).
We additionally verified these results in MTT assays confirming the reduced proliferation of RDEB-SCC cells upon incubation with calcipotriol, which was significant at the treatment concentration of 100 nM (Fig. 5e). Vitamin D’s inhibitory effects on cell proliferation have been partially attributed to cell cycle arrest via upregulation of the cyclin-dependent kinase inhibitor CDKN1A, also known as p21WAF1/Cip128. p21 is known primarily for its role in promoting cell cycle arrest, but is also involved in induction of differentiation and senescence29. We also investigated the impact of treatment on expression of E-cadherin, also reported to be modulated by the VDR30,31,32,33, and which mediates cell–extracellular matrix (ECM) and cell–cell interactions that regulate cell fate and differentiation34, including cell-cell contact-mediated inhibition of cell proliferation (as reviewed in35). After 24 hours of treatment, we observed a modest increase in p21 protein levels by Western blotting, particularly in RDEB-SCC62 cells, which was most sensitive to the anti-neoplastic effects of calcipotriol in our assays (Suppl. Fig. S3a). Immunofluorescence assays demonstrated enhanced membrane expression of E-cadherin in both tumor cell lines after 48 hours treatment with 100 nM calcipotriol (Suppl. Fig. S3b), in keeping with previously published reports in murine SCC36.
Treatment with low-dose calcipotriol ointment demonstrates efficacy in single-patient observation study
In contrast to human and primates, the expression of cathelicidin is not regulated by vitamin D in rodents14. The nocturnal life of these animals excludes them from vitamin D photosynthesis37. Since we postulated that calcipotriol exerts its antimicrobial and wound healing effects primarily via direct induction of cathelicidin, and because of well-documented species-specific differences in skin wound healing38, in vivo wound healing studies in mice would not fully recapitulate the human system in this respect, thereby potentially limiting the successful translation of experimental results into clinical application. We therefore performed a single-patient observation study in order to provide a first proof-of-concept as well as investigate potential safety issues of our approach. To this end, a low-dose calcipotriol ointment (0.05 µg/g in Ultraphil®, ~100 nM) was produced by our in-house compounding pharmacy and applied daily, over a period of one month, to a chronic wound of a 75-year-old dominant dystrophic EB (DDEB) patient. Images and wound swabs for microbial analyses were taken prior to treatment and on days 14 and 28 after the start of the intervention (Fig. 6a). We observed complete closure of the wound within the first 2 weeks of treatment, which did not re-open during the remainder of the treatment phase. The patient showed no signs of hypercalcemia as blood calcium levels remained within normal range upon application of the drug (calcium 2.13–2.63 ng/ml), suggesting that application of calcipotriol onto an open wound did not result in significant systemic uptake of the drug. Notably, the patient reported a reduced burden of itch and pain on the wounded area treated with calcipotriol.
Finally, we assessed wound microbiota before and during calcipotrol treatment using shotgun whole-metagenomic sequencing. We observed reduced microbial diversity in the chronic wound compared to corresponding intact skin (Ctrl skin) of the patient. The wound was exclusively colonized with S. aureus at the start of intervention (Fig. 6b). This observation corresponds with recent data showing low microbial diversity in RDEB wounds and higher susceptibility to Staphylococcus infection in EB patients39,40. Notably, treatment with low-dose calcipotriol ointment improved the diversity of the skin microbiota on the affected area already after 14 days, with complete clearance of S. aureus by the end of the treatment (day 28).
Discussion
Our data demonstrate that, in at least a subset of RDEB keratinocytes, treatment with a low concentration (100 nM) of calcipotriol can induce expression of the antimicrobial peptide cathelicidin, enhance wound gap closure, and increase local antimicrobial defense against C. albicans in vitro. The observed effects, though significant, were rather small. However, in vitro systems cannot fully recapitulate the multi-faceted process of wound healing, especially the contribution of the immune system to this process. Notably, the cathelicidin locally-produced by keratinocytes can serve as a chemoattractant for innate immune cells including neutrophils, which store vast amounts of AMPs16, and mast cells, which subsequently produce more LL-3741, to the site of injury. Release of AMPs by these supporting cells results in an amplification of the effect, underscoring the utility of this approach in conditions characterized by increased susceptibility to bacterial infections and chronic wounds, such as RDEB. Accordingly, we observed robust wound healing of a long-standing wound of a DDEB patient, along with a reversal of skin microbial dysbiosis, within 2 weeks of treatment with a low-dose calcipotriol ointment. Previous investigations have clearly demonstrated that reduced microbial diversity is associated with disease in various settings, including cancer, autoimmune diseases, inflammatory diseases, and chronic leg ulcers42,43. In line with this, we recently showed reduced microbial diversity and an increased abundance of Staphylococcus species in RDEB wounds compared to unwounded skin39. Amongst this species, S. aureus is considered as a pathogenic species known to cause infections in hospitalized patients, impeding the healing process and contributing to the pathophysiology of different diseases44. Reduced microbial diversity is accompanied with increased bacterial load of pathogenic microbes (i.e., dysbiosis) which elicits an imbalance of the microbial wound communities driving chronicity and impaired healing process (as reviewed in45). In our single-patient observation we demonstrate that calcipotriol application is associated with increased microbial diversity at the wound site and, most notably, the reduction of the pathogen S. aureus. Besides S. aureus and C. albicans, other common wound colonizers in EB include Streptococcus and Pseudomonas species25. Both species have been shown in several studies to be targetable by LL-3741,46, pointing to a broad antimicrobial spectrum potentially achievable by this strategy, although this remains to be confirmed in the background of EB.
Vitamin D has also been reported to enhance the expression of human beta defensin 2 (DEFB2/HBD2), which belongs to a separate class of antimicrobial peptide, in human keratinocytes, although to a much lower extent as compared to hCAP1847. However, we found no evidence of significant differential expression in DEFB2/HBD2 between NHK and RDEB keratinocytes, and saw only a modest upregulation of DEFB2/HBD2 upon treatment with calcipotriol in vitro, confirming previously published observations (Suppl. Fig. S4). Thus, we ascribe the positive effects on wound healing and antimicrobial defense that we observed in our in vitro experiments primarily to the vitamin D3/cathelicidin axis. However, the contribution of other AMPs induced by treatment cannot be ruled out in our single-patient observation study.
Our results also highlight the anti-neoplastic potential of calcipotriol against RDEB tumor cells which is a critical consideration for these patients, given their high risk of developing tumors in areas of chronic wounding. Because of the significant overlap between cellular processes involved in wound healing and tumorigenesis, a major challenge in the field is the development of strategies that will enhance wound healing processes without promoting malignant transformation or vice versa, abrogating tumor progression without inhibiting wound healing. This challenge is underscored by our own clinical experience of the limited applicability of targeted anti-cancer therapies such as the EGFR inhibitor Cetuximab in RDEB-SCC patients. While effective in inhibiting growth of EGFR-positive wt RAS RDEB-SCC cells in vitro (Suppl. Fig. S5) and in a patient, the debilitating effect on wound healing severely limited its long-term application in this patient (our unpublished observations). In this regard, our observations that calcipotriol could elicit wound healing effects in several RDEB cell lines while inhibiting the outgrowth of single malignant clones is noteworthy and merits further investigation. Our initial investigations demonstrate induction of known tumor suppressors such as p21 and E-cadherin in response to treatment. However, the precise pathways that account for the observed anti-neoplastic effects in RDEB-SCC are not yet completely understood. The pathways modulated by vitamin D/VDR are expected to be manifold, cell type-specific, and will likely be subject to inter-donor variability, requiring comprehensive and integrative –omics approaches coupled with machine-learning data analyses to discern the relevant pathways involved.
An important question raised by our study is whether RDEB patients have a deficiency in vitamin D3 and whether this can be effectively addressed by oral supplementation. Several studies have shown that vitamin D deficiency is prevalent in RDEB patients21,48, and that this correlates with low bone mineral density19. Data from our clinic confirms that the majority of DEB patients (72%) have insufficient to deficient serum levels of 25(OH)D3 (Suppl. Fig. S6), despite strong recommendation for oral supplementation. This observation is not different from that reported for the general population49, but in the context of a disease wherein ongoing tissue repair is needed, such a deficiency is likely to have more pronounced consequences. While systemic oral vitamin D supplementation is critical to address issues of low bone density in patients, we propose that the local tissue concentration of vitamin D is critical for proper skin function. Using hCAP18 as a surrogate marker for activation of vitamin D3-mediated wound healing pathways, we observed reduced levels of hCAP18 mRNA and protein in skin biopsies of some RDEB patients although this did not reach statistical significance (Suppl. Fig. S6). However, as the biopsies were derived from non-wounded skin, these assays do not reflect the situation in an RDEB wound, wherein large sections of the epidermis are lost along with the capacity to actively generate sufficient quantities of calcitriol to support efficient wound healing. Additionally, at least some RDEB keratinocytes may have intrinsic defects in generating calcitriol, severely limiting their ability to respond to injury. For example, in RDEB-2, the most responsive cell line in our study with the lowest basal levels of hCAP18, gene expression profiling identified a significant decrease in the expression of CYP2R1 and CYP27B1, enzymes involved in the generation of calcidiol and calcitriol respectively (Suppl. Fig. S7). Direct topical application of the active metabolite onto chronic wounds where it is critically needed to support local tissue repair would circumvent such deficiencies.
An important aspect of our study is finding the correct concentration of calcipotriol that induces positive wound healing effects in RDEB keratinocytes, which is much lower than the concentration present in the topical ointment used against psoriasis (Psorcutan® 50 µg/g calcipotriol, approximately 121 µM). Based on the data presented here, we have initiated a small clinical trial to assess the efficacy of a low-dose topical application of calcipotriol in improving wound healing in DEB patients. The phase II double-blind, placebo-controlled, randomized, cross-over design study (CALCIDEB2016 Eudranet 2016-001967-35) will address some of the shortcomings of the single-patient observation study presented here, such as the lack of a placebo control, and will enroll both children and adults, thereby allowing for potential correlations to be drawn between age and efficacy of treatment. It could be argued that perhaps direct application of LL-37 might be more effective, as the bulk of vitamin D’s wound healing effects is believed to be mediated via the action of this peptide. A recently concluded Phase I/II trial of hard-to-treat venous leg ulcers demonstrated that treatment with LL-37 (0.5 mg/ml) significantly improved wound healing as compared with placebo50. However, several studies show that LL-37 is overexpressed in multiple tumor types, where it is thought to promote tumor cell proliferation, migration, and invasion51,52,53,54,55,56. LL-37 appears to exert contrasting effects, either pro- or anti-tumorigenic, in a tumor/tissue-specific manner57. Thus, while the exact nature of the role of LL-37 in the pathophysiology of RDEB-SCC is unknown, we advocate the use of calcipotriol which demonstrated clear anti-neoplastic effects independent of LL-37 at least at the doses examined. Additionally, the known safety profile of calcipotriol facilitates a rapid re-purposing for off-target use in DEB.
While all keratinocyte lines tested responded to calcipotriol by induction of cathelicidin, this effect was robust in only 2 out of 5 lines, with only one of these further showing improvements in all in vitro assays shown here. The in vitro data suggest that this strategy may benefit only a subset of patients and represents a major limitation of this study. Indeed, in going forward, potential inadequacies in the generation of calcitriol, as well as additional deficiencies in the sensing and response to injury both upstream and downstream of the VDR, warrant closer examination in larger patient cohorts. Likewise, a comprehensive cellular and molecular characterization of what defines a chronic wound will likely contribute to our understanding of what drives defective wound healing in DEB. The integration of data derived from such analyses together with the results from the ongoing clinical trial will provide novel insights that, in the future, will enable the identification of those patients (or wounds) that would benefit most from this treatment strategy.
Materials and Methods
Reagents
Calcipotriol (Sigma-Aldrich, St. Louis, MO) was dissolved in DMSO (Sigma-Aldrich). LL-37 peptide [[LL-37, 37 aa]] was ordered from GL Biochem, Shanghai, China and dissolved in DMSO.
Single patient observation
A 75-year-old dominant dystrophic EB (DDEB) patient (COL7A1, c.6127 G > A) volunteered to participate in an observation study involving topical application of a low-dose calcipotriol ointment. The patient intervention was performed with written informed consent at the EB House Austria, Department of Dermatology, with approval of and in accordance with the guidelines of the University Hospital Salzburg and the Declaration of Helsinki (ethical approval number 415-E/2043/9-2016). The wound site to be treated was chosen together with the patient in order to take into account the patient’s needs and wishes. The chosen wound was in an area that was persistently affected in the patient and, as per the patient’s description, had been open for several weeks and was associated with high burden of itch and pain. The low-dose calcipotriol ointment was produced by our in-house pharmacy by diluting Psorcutan® in Ultraphil® to a final concentration of 0.05 µg/g. One gram of ointment was applied to a chronic wound on the lower left leg on a daily basis over a time period of 4 weeks. The patient was advised to apply the calcipotriol ointment onto the wound site without changing their daily wound dressing. Importantly, no other ointment or cream was used during the intervention phase at this site. The patient was asked to come into the clinic every 2 weeks for monitoring and to take pictures of the treated skin area. In addition microbial swabs were taken from wound and corresponding intact skin on the other side of the body at each study visit which served as control (Ctrl). A clinical follow-up was done 2 month after finishing calcipotriol treatment.
Cell lines and tissue samples
The skin biopsies used in our study were taken under the course of a routine examination at the Department of Dermatology, University Hospital Salzburg. The remaining tissue was used for scientific research after written informed consent of the patients and/or their legal guardians. The Salzburg State Ethics Committee approved the usage of these tissue samples for scientific research (415-EP/73/192-2013). All experiments were conducted in accordance with the Declaration of Helsinki. Details on tissue samples are given in Suppl. Table S1.
Detailed information on cell lines are outlined in Suppl. Table S2. Cell lines RDEB-1,-3 and-5 were generously provided by Prof. Guerrino Meneguzzi, INSERM, Nice, France. RDEB-2 cells have been described previously as RDEB-T4 by Chamorro et al.58 and were a gift from Prof. Fernando Larcher, CIEMAT-CIBERER, Madrid, Spain. RDEB-SCC1 cells were generously provided by Prof. Leena Bruckner-Tuderman, Freiburg, Germany. RDEB-4, RDEB-SCC62 and NHK cell lines were generated in our own lab using standard isolation techniques. Genomic mutations associated with each cell line were confirmed by standard sequencing techniques. In addition, cell cultures were routinely checked for mycoplasma contamination.
RDEB and normal human keratinocytes (NHK) were maintained in EpiLife® medium (Life Technologies, Carlsbad, CA) supplemented with human keratinocytes growth supplement (Life Technologies) and penicillin/streptomycin where indicated. RDEB-SCC cells were maintained in DMEM/Ham’s F-12 (2:1) (Hyclone) containing 10% serum and growth factors according to the protocol of Rheinwald and Green59. All cells were cultured at 37 °C and 5% CO2 in a humidified chamber.
Semi quantitative real-time PCR (sqRT-PCR)
RNA was isolated from cultured cells or tissue samples using the RNeasy Mini Kit or RNeasy Lipid tissue Mini Kit (Qiagen, Hilden, Germany). 1 µg of each RNA sample was treated with DNase I (Sigma-Aldrich) for 20 min at RT. The reaction was stopped by the addition of Stop solution and incubation at 70 °C for 10 minutes. cDNA synthesis was performed using iScript cDNA Synthesis Kit (Bio-Rad, Hercules, CA) according to manufacturer’s protocol. Expression of cathelicidin (hCAP18) and GAPDH was assessed by sqRT-PCR using the IQ SYBR Green Kit (Biorad). Briefly, the reaction consisted of 6.5 µl IQ SYBR Green Supermix 2x (Bio-Rad), 0.5 µL of forward and reverse primer mix (10 µM each) (see Suppl. Table S3 for primer sequences) and 12.5 ng cDNA in a total volume of 13 µl. Each PCR experiment was conducted in duplicates or triplicates and repeated three times or two times, respectively. The PCR reaction was performed in a CFX96 Real Time System C1000 Thermal Cycler (Bio-Rad) under the following conditions: 5 min denaturation phase at 95 °C, followed by 50 cycles with 20 sec denaturation at 95 °C, 20 sec primer annealing at 60 °C, and 20 sec primer extension at 72 °C. To investigate the specificity of the resulting PCR product, an additional melting curve analysis was performed (95 °C for 10 min, 65–95 °C in 0.5 °C increments for 5 sec).
Western blot and Dot blot analysis
Whole cell protein lysates were prepared by harvesting cells in RIPA Buffer (Santa Cruz Biotechnology, Santa Cruz, CA). Lysates were incubated on ice for 30 minutes followed by a 3 min centrifugation step at maximum speed (≥10.000 × g). Supernatants containing soluble proteins were mixed with 4x SDS-PAGE Laemmli sample buffer, heated for 5 minutes at 95 °C and separated on a 4–12% BisTrisNuPage gel (Life technologies) under denaturating conditions for 75 min at 120–150 V. The Precision Plus Protein WesternC Standard (Bio-Rad) was used as molecular weight marker. Proteins were electro-blotted onto a nitrocellulose membrane (AmershamTMHybondTM ECL, GE Healthcare, Little Chalfont, UK) using a wet tank blotting system (Bio-Rad) for 75 min at 250 mA at 4 °C. Unspecific antibody binding sites were blocked with 5% non-fat milk in TBST (10 mM Tris, pH 8.0, 150 mM NaCl, 0.5% Tween 20) for 1 hr, membranes were incubated with antibodies against LL-37 (1:250; Abcam, Cambridge, UK) over night at 4 °C. Membranes were washed three times and incubated with horseradish peroxidase-conjugated anti-rabbit antibodies for 1 hr at room temperature. Blots were washed three times and developed with the Immun-Star WesternC Kit (Bio-Rad) or Immobilon Western Chemiluminescence HRP Substrate (Merck Millipore, Billerica, MA) and visualized with a ChemiDoc XRS Imager (Bio-Rad). Afterwards the blot was stripped to remove antibodies with ReBlot plus mild antibody stripping solution (Millipore, Darmstadt, Germany) for 15 min at room temperature and reprobed using anti-GAPDH antibody (1:10000, DAKO) for 1 hr at room temperature. Subsequent procedures were performed as described above.
For detection of cathelicidin in conditioned medium, 1.5 × 105 cells were seeded in 12 well plates and treated with 100 nM calcipotriol or DMSO for 48 hrs. Protease inhibitors (Complete Mini, Roche, Mannheim, Germany) were added to the harvested supernatants which were then concentrated using Amicon Ultra-0.5 Centrifugal Filter Unit with Ultracel-3 membrane devices (Merck Millipore). The concentrates (3 µl) were spotted onto 0.45 µm nitrocellulose membranes (GE Healthcare) and dried for 1 hr. Membranes were blocked, probed with antibodies, and developed as described above.
Immunofluorescence analysis
Keratinocytes were seeded in 2-well chamber slides (Thermo Scientific, Braunschweig, Germany) in EpiLife medium without antibiotics and treated with 100 nM calcipotriol or vehicle (DMSO) control for 48 hours. Cells were washed with PBS and fixed with 4% paraformaldehyde for 15 min at room temperature. Cells were washed twice, blocked with 4% BSA in 0.1%Triton X-100/PBS for 1 hour, and then incubated with anti-LL-37 antibody (1:200, Abcam) overnight at 4 °C. Following incubation with goat anti-rabbit Alexa Fluor® 488 (Life Technologies) for 1 hr at room temperature, cells were washed twice with PBS and mounted with SlowFade® Gold Antifade Mountant containing DAPI (Life Technologies). Immunofluorescence images were captured using a confocal laser scanning microscope (Axio Observer Z1 attached to LSM 710, Zeiss, Germany).
Scratch assay
Keratinocytes were seeded in 12-well plates and grown to confluence. A standardized scratch was made with a 100 µl pipette tip. Cell debris was washed away and EpiLife Medium lacking growth factors and containing either 100 nM calcipotriol or vehicle control (DMSO) was added. Cells were maintained in an Okolab incubation system combined with a Nikon Eclipse Ti microscope fitted with an automatic stage. Scratched areas (3 per well) were photographed every 15 minutes for up to 48 hrs. Images were analysed using NIS elements imaging software AR 4.30.02. The width of the scratch at indicated time points were normalized to t0 values and substracted from 100% to estimate percent wound closure.
MTT Assay
Cells were seeded into 96-well pates at a density of 5,000 cells/well. The following day, medium containing increasing concentrations of calcipotriol or DMSO was added. Cell viability was assessed after 72 hrs by MTT assay. Briefly, 20 µl of the tetrazolium dye MTT solution (5 g/L) were added to each well and incubated for 2 hours at 37 °C, 5% CO2. Cell culture supernatants were removed and cells were lysed by adding 100 µl of DMSO/glycine (6 vol DMSO + 1 vol 0.1 M glycine/NaOH, pH 10.2). Reduction of MTT to formazan was measured at 492 nm/620 nm using a plate photometer (Spark 10 M, Tecan). Each experiment was carried out at least in triplicates.
Antimicrobial activity
Keratinocytes were cultured in 12-well plates for 48 hrs in EpiLife medium supplemented with either 100 nM calcipotriol or DMSO and without antibiotics. C. albicans or P. aeruginosa (patient isolate) were grown to early log phase in Luria broth (LB). 35,000 colony forming units/well were seeded into a 96-well black microplate (Greiner Bio-One, Kremsmünster, Austria) and 100 µl of conditioned cell culture medium from untreated or treated cells were added. After 3 hrs incubation at 37 °C, 100 µl of resazurin solution (0.5 nM Resazurin, Sigma-Aldrich) was added. Plates were incubated at 37 °C overnight in a Spark 10 M multiplate reader (Tecan, Grödig, Austria) which measured fluorescence at Ex 535 nm/Em 590 nm every hour. C. albicans and P. aeruginosa were treated directly with increasing concentrations of LL-37, 100 nM calcipotriol, or DMSO served as controls.
Clonogenicity assay
RDEB-SCC cells were plated at a density of 3 cells/cm² in T175 cell culture flasks. The next day the medium was replaced with medium supplemented with either 100nnM calcipotriol or DMSO. Fresh medium was added weekly and after an incubation period of up to 18 days cells were washed with PBS, fixed with 4% paraformaldehyde, and stained with 0.05% crystal violet. Following several washes with water, the flasks were air-dried and photographed. Additionally, individual clones were photographed using a Nikon SMZ 745T.
DNA extraction and metagenomic sequencing
DNA was extracted from swabs that were transferred into Lysing Matrix E tubes (MP Biomedicals) with 500 μl of ATL Buffer (Qiagen). Samples were subjected to bead-beating in a FastPrep-24 Instrument (MP Biomedicals) at 6.0 m/s for 40 s and then centrifuged at 16,000 × g for 5 min. 200 μL of the supernatant were treated with Proteinase K (Qiagen) and incubated at 56 °C for 15 min before extraction in the EZ1 Advanced XL Instrument (Qiagen) using the EZ1 DNA Tissue Kit (Qiagen) according to the manufacturer’s protocol. DNA concentration was quantified using a Qubit fluorometer and the Qubit dsDNA HS Assay Kit (Life Technologies).
DNA libraries were constructed with 50 μL of extracted DNA after shearing by Adaptive Focused Acoustics™ technology (Covaris) using the GeneRead DNA Library I Core Kit (Qiagen). Custom index primers were used for the enrichment of DNA libraries with 14 cycles of PCR. Libraries were quantified using the Agilent DNA 1000 Kit (Agilent Technologies) on an Agilent 2100 Bioanalyzer (Agilent Technologies), normalized and pooled in equimolar concentrations for 101 bp paired-end sequencing on an Illumina HiSeq2000 Instrument at the Next Generation Sequencing Platform (Genome Institute of Singapore).
Bioinformatics analysis
Demultiplexed reads were subjected to the following preprocessing steps: sequencing bases with quality score <3 were trimmed, and reads <30 bp in length were removed from the analysis using FAMAS (https://github.com/andreas-wilm/famas). Subsequent reads were mapped to the human reference genome (GRCh38) using BWA-MEM60 (version 0.7.10-r789) and human host reads were removed from further analysis. MetaPhlAn v2.061 with default parameters was used to profile the microbial composition at each taxonomic level. Shannon diversity indices were calculated using the vegan package in R (version 2.4–5) and all plots were generated with ggplot2 in R.
Nucleotide sequence accession numbers
Metagenome data have been submitted to NCBI Sequence Read Archive and are accessible through BioProject ID PRJNA488682.
Statistical analysis
All statistical analyses were performed using GraphPad Prism 5.0 Software. Data were analyzed for normal distribution using Kolmogorov-Smirnov test, D’Agostino & Pearson omnibus normality test and Shapiro-Wilk normality test. Where the data in the two groups to be compared were normally distributed, the unpaired t-test (two-tailed) was used. Where the data to be compared were not normally distributed, the Mann-Whitney test (two-tailed) was used. Results were considered significant when P ≤ 0.05; *P ≤ 0.05, **P ≤ 0.01, ***P ≤ 0.001.
References
Fine, J. D. Inherited epidermolysis bullosa. Orphanet J Rare Dis 5, 12, https://doi.org/10.1186/1750-1172-5-12 (2010).
Burgeson, R. E. Type VII collagen, anchoring fibrils, and epidermolysis bullosa. J Invest Dermatol 101, 252–255 (1993).
Cianfarani, F., Zambruno, G., Castiglia, D. & Odorisio, T. Pathomechanisms of Altered Wound Healing in Recessive Dystrophic Epidermolysis Bullosa. Am J Pathol 187, 1445–1453, https://doi.org/10.1016/j.ajpath.2017.03.003 (2017).
Fine, J. D., Johnson, L. B., Weiner, M., Li, K. P. & Suchindran, C. Epidermolysis bullosa and the risk of life-threatening cancers: the National EB Registry experience, 1986–2006. J Am Acad Dermatol 60, 203–211, https://doi.org/10.1016/j.jaad.2008.09.035 (2009).
Kim, M. & Murrell, D. F. Update on the pathogenesis of squamous cell carcinoma development in recessive dystrophic epidermolysis bullosa. Eur J Dermatol 25(Suppl 1), 30–32, https://doi.org/10.1684/ejd.2015.2552 (2015).
Hoste, E. et al. Innate sensing of microbial products promotes wound-induced skin cancer. Nat Commun 6, 5932, https://doi.org/10.1038/ncomms6932 (2015).
El Hachem, M. et al. Multicentre consensus recommendations for skin care in inherited epidermolysis bullosa. Orphanet J Rare Dis 9, 76, https://doi.org/10.1186/1750-1172-9-76 (2014).
Denyer, J., Pillay, E. & Clapham, J. Best practice guidlines for skin and wound care in epidermolysis bullosa. An International Consensus. Wounds International (2017).
Flohr, C., Heague, J., Leach, I. & English, J. Topical silver sulfadiazine-induced systemic argyria in a patient with severe generalized dystrophic epidermolysis bullosa. Br J Dermatol 159, 740–741, https://doi.org/10.1111/j.1365-2133.2008.08690.x (2008).
Schwieger-Briel, A. et al. Grey spots in a patient with dystrophic epidermolysis bullosa. Br J Dermatol 163, 1124–1126, https://doi.org/10.1111/j.1365-2133.2010.09900.x (2010).
Drucker, C. R. Update on topical antibiotics in dermatology. Dermatol Ther 25, 6–11, https://doi.org/10.1111/j.1529-8019.2012.01493.x (2012).
Bikle, D. D. Vitamin D metabolism and function in the skin. Mol Cell Endocrinol 347, 80–89, https://doi.org/10.1016/j.mce.2011.05.017 (2011).
Oda, Y. et al. Vitamin D receptor and coactivators SRC2 and 3 regulate epidermis-specific sphingolipid production and permeability barrier formation. J Invest Dermatol 129, 1367–1378, https://doi.org/10.1038/jid.2008.380 (2009).
Gombart, A. F., Borregaard, N. & Koeffler, H. P. Human cathelicidin antimicrobial peptide (CAMP) gene is a direct target of the vitamin D receptor and is strongly up-regulated in myeloid cells by 1,25-dihydroxyvitamin D3. FASEB J 19, 1067–1077, https://doi.org/10.1096/fj.04-3284com (2005).
Izadpanah, A. & Gallo, R. L. Antimicrobial peptides. J Am Acad Dermatol 52 381–390; quiz 391–382 https://doi.org/10.1016/j.jaad.2004.08.026 (2005).
Zanetti, M. C. multifunctional peptides of the innate immunity. J Leukoc Biol 75, 39–48, https://doi.org/10.1189/jlb.0403147 (2004).
Braff, M. H. & Gallo, R. L. Antimicrobial peptides: an essential component of the skin defensive barrier. Curr Top Microbiol Immunol 306, 91–110 (2006).
Lopez-Garcia, B., Lee, P. H., Yamasaki, K. & Gallo, R. L. Anti-fungal activity of cathelicidins and their potential role in Candida albicans skin infection. J Invest Dermatol 125, 108–115, https://doi.org/10.1111/j.0022-202X.2005.23713.x (2005).
Carretero, M. et al. In vitro and in vivo wound healing-promoting activities of human cathelicidin LL-37. J Invest Dermatol 128, 223–236, https://doi.org/10.1038/sj.jid.5701043 (2008).
Koczulla, R. et al. An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. J Clin Invest 111, 1665–1672, https://doi.org/10.1172/JCI17545 (2003).
Bruckner, A. L. et al. Correlates of low bone mass in children with generalized forms of epidermolysis bullosa. J Am Acad Dermatol 65, 1001–1009, https://doi.org/10.1016/j.jaad.2010.08.028 (2011).
Lebwohl, M., Menter, A., Koo, J. & Feldman, S. R. Combination therapy to treat moderate to severe psoriasis. J Am Acad Dermatol 50, 416–430, https://doi.org/10.1016/j.jaad.2002.12.002 (2004).
Takahashi, H. et al. Similarly potent action of 1,25-dihydroxyvitamin D3 and its analogues, tacalcitol, calcipotriol, and maxacalcitol on normal human keratinocyte proliferation and differentiation. J Dermatol Sci 31, 21–28 (2003).
Braff, M. H., Di Nardo, A. & Gallo, R. L. Keratinocytes store the antimicrobial peptide cathelicidin in lamellar bodies. J Invest Dermatol 124, 394–400, https://doi.org/10.1111/j.0022-202X.2004.23443.x (2005).
Brandling-Bennett, H. A. & Morel, K. D. Common wound colonizers in patients with epidermolysis bullosa. Pediatr Dermatol 27, 25–28, https://doi.org/10.1111/j.1525-1470.2009.01070.x (2010).
Christakos, S., Dhawan, P., Verstuyf, A., Verlinden, L. & Carmeliet, G. Vitamin D: Metabolism, Molecular Mechanism of Action, and Pleiotropic Effects. Physiol Rev 96, 365–408, https://doi.org/10.1152/physrev.00014.2015 (2016).
Munshi, A., Hobbs, M. & Meyn, R. E. Clonogenic cell survival assay. Methods Mol Med 110, 21–28, https://doi.org/10.1385/1-59259-869-2:021 (2005).
Liu, M., Lee, M. H., Cohen, M., Bommakanti, M. & Freedman, L. P. Transcriptional activation of the Cdk inhibitor p21 by vitamin D3 leads to the induced differentiation of the myelomonocytic cell line U937. Genes Dev 10, 142-153 (1996).
Abbas, T. & Dutta, A. p21 in cancer: intricate networks and multiple activities. Nat Rev Cancer 9, 400-414. https://doi.org/10.1038/nrc2657 (2009).
Chen, S. et al. 1,25(OH)2D3 attenuates TGF-beta1/beta2-induced increased migration and invasion via inhibiting epithelial-mesenchymal transition in colon cancer cells. Biochem Biophys Res Commun 468, 130–135, https://doi.org/10.1016/j.bbrc.2015.10.146 (2015).
Lopes, N. et al. 1Alpha,25-dihydroxyvitamin D3 induces de novo E-cadherin expression in triple-negative breast cancer cells by CDH1-promoter demethylation. Anticancer Res 32, 249–257 (2012).
Palmer, H. G. et al. Vitamin D(3) promotes the differentiation of colon carcinoma cells by the induction of E-cadherin and the inhibition of beta-catenin signaling. J Cell Biol 154, 369–387 (2001).
Shabahang, M. et al. 1,25-Dihydroxyvitamin D3 receptor as a marker of human colon carcinoma cell line differentiation and growth inhibition. Cancer Res 53, 3712–3718 (1993).
Charest, J. L., Jennings, J. M., King, W. P., Kowalczyk, A. P. & Garcia, A. J. Cadherin-mediated cell-cell contact regulates keratinocyte differentiation. J Invest Dermatol 129, 564–572, https://doi.org/10.1038/jid.2008.265 (2009).
Klezovitch, O. & Vasioukhin, V. Cadherin signaling: keeping cells in touch. F1000Res 4, 550, https://doi.org/10.12688/f1000research.6445.1 (2015).
Ma, Y. et al. Regulation of motility, invasion, and metastatic potential of squamous cell carcinoma by 1alpha,25-dihydroxycholecalciferol. Cancer 119, 563–574, https://doi.org/10.1002/cncr.27531 (2013).
Liu, P. T. et al. Toll-like receptor triggering of a vitamin D-mediated human antimicrobial response. Science 311, 1770–1773, https://doi.org/10.1126/science.1123933 (2006).
Zomer, H. D. & Trentin, A. G. Skin wound healing in humans and mice: Challenges in translational research. J Dermatol Sci 90, 3–12, https://doi.org/10.1016/j.jdermsci.2017.12.009 (2018).
Fuentes, I. et al. Reduced microbial diversity is a feature of recessive dystrophic epidermolysis bullosa involved skin and wounds. J Invest Dermatol. https://doi.org/10.1016/j.jid.2018.04.026 (2018).
van der Kooi-Pol, M. M., Duipmans, J. C., Jonkman, M. F. & van Dijl, J. M. Host-pathogen interactions in epidermolysis bullosa patients colonized with Staphylococcus aureus. Int J Med Microbiol 304, 195–203, https://doi.org/10.1016/j.ijmm.2013.11.012 (2014).
Di Nardo, A., Vitiello, A. & Gallo, R. L. Cutting edge: mast cell antimicrobial activity is mediated by expression of cathelicidin antimicrobial peptide. J Immunol 170, 2274–2278 (2003).
Gardiner, M. et al. A longitudinal study of the diabetic skin and wound microbiome. PeerJ 5, e3543, https://doi.org/10.7717/peerj.3543 (2017).
Thomas, S. et al. The Host Microbiome Regulates and Maintains Human Health: A Primer and Perspective for Non-Microbiologists. Cancer Res 77, 1783–1812, https://doi.org/10.1158/0008-5472.CAN-16-2929 (2017).
Kobayashi, S. D., Malachowa, N. & DeLeo, F. R. Pathogenesis of Staphylococcus aureus abscesses. Am J Pathol 185, 1518–1527, https://doi.org/10.1016/j.ajpath.2014.11.030 (2015).
Scales, B. S. & Huffnagle, G. B. The microbiome in wound repair and tissue fibrosis. The Journal of pathology 229, 323–331, https://doi.org/10.1002/path.4118 (2013).
Beaumont, P. E. et al. Cathelicidin host defence peptide augments clearance of pulmonary Pseudomonas aeruginosa infection by its influence on neutrophil function in vivo. PloS one 9, e99029, https://doi.org/10.1371/journal.pone.0099029 (2014).
Wang, T. T. et al. Cutting edge: 1,25-dihydroxyvitamin D3 is a direct inducer of antimicrobial peptide gene expression. J Immunol 173, 2909–2912 (2004).
Ingen-Housz-Oro, S., Blanchet-Bardon, C., Vrillat, M. & Dubertret, L. Vitamin and trace metal levels in recessive dystrophic epidermolysis bullosa. J Eur Acad Dermatol Venereol 18, 649–653, https://doi.org/10.1111/j.1468-3083.2004.01067.x (2004).
Thuesen, B. et al. Determinants of vitamin D status in a general population of Danish adults. Bone 50, 605–610, https://doi.org/10.1016/j.bone.2011.12.016 (2012).
Gronberg, A., Mahlapuu, M., Stahle, M., Whately-Smith, C. & Rollman, O. Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial. Wound Repair Regen 22, 613–621, https://doi.org/10.1111/wrr.12211 (2014).
Coffelt, S. B. et al. The pro-inflammatory peptide LL-37 promotes ovarian tumor progression through recruitment of multipotent mesenchymal stromal cells. Proc Natl Acad Sci USA 106, 3806–3811, https://doi.org/10.1073/pnas.0900244106 (2009).
Coffelt, S. B., Tomchuck, S. L., Zwezdaryk, K. J., Danka, E. S. & Scandurro, A. B. Leucine leucine-37 uses formyl peptide receptor-like 1 to activate signal transduction pathways, stimulate oncogenic gene expression, and enhance the invasiveness of ovarian cancer cells. Mol Cancer Res 7, 907–915, https://doi.org/10.1158/1541-7786.MCR-08-0326 (2009).
Coffelt, S. B. et al. Ovarian cancers overexpress the antimicrobial protein hCAP-18 and its derivative LL-37 increases ovarian cancer cell proliferation and invasion. Int J Cancer 122, 1030–1039, https://doi.org/10.1002/ijc.23186 (2008).
Gill, K., Mohanti, B. K., Singh, A. K., Mishra, B. & Dey, S. The over expression of cathelicidin peptide LL37 in head and neck squamous cell carcinoma: the peptide marker for the prognosis of cancer. Cancer Biomark 10, 125–134, https://doi.org/10.3233/CBM-2012-0238 (2011).
Hensel, J. A. et al. LL-37 as a therapeutic target for late stage prostate cancer. Prostate 71, 659–670, https://doi.org/10.1002/pros.21282 (2011).
von Haussen, J. et al. The host defence peptide LL-37/hCAP-18 is a growth factor for lung cancer cells. Lung Cancer 59, 12–23, https://doi.org/10.1016/j.lungcan.2007.07.014 (2008).
Piktel, E. et al. The Role of Cathelicidin LL-37 in Cancer Development. Arch Immunol Ther Exp (Warsz) 64, 33–46, https://doi.org/10.1007/s00005-015-0359-5 (2016).
Chamorro, C. et al. Keratinocyte cell lines derived from severe generalized recessive epidermolysis bullosa patients carrying a highly recurrent COL7A1 homozygous mutation: models to assess cell and gene therapies in vitro and in vivo. Exp Dermatol 22, 601–603, https://doi.org/10.1111/exd.12203 (2013).
Rheinwald, J. G. & Green, H. Formation of a keratinizing epithelium in culture by a cloned cell line derived from a teratoma. Cell 6, 317–330 (1975).
Li, H. & Durbin, R. Fast and accurate short read alignment with Burrows-Wheeler transform. Bioinformatics (Oxford, England) 25, 1754–1760, https://doi.org/10.1093/bioinformatics/btp324 (2009).
Segata, N. et al. Metagenomic microbial community profiling using unique clade-specific marker genes. Nature methods 9, 811–814, https://doi.org/10.1038/nmeth.2066 (2012).
Acknowledgements
This project was funded by the Paracelsus Medical University Salzburg Research Fund (R-11/03/027GRU to Christina Guttmann-Gruber) and DEBRA Austria. We would like to thank the patient who participated in the observational study. Furthermore we thank Prof. Leena Bruckner-Tuderman, Prof. Fernando Larcher and Prof. Guerrino Meneguzzi for providing RDEB cells. Finally we want to thank Prof. Markus Hell for providing patient isolates of C. albicans and P. aeruginosa.
Author information
Authors and Affiliations
Contributions
C.G.G., J.P.H. and R.L. designed and directed the study, analysed and interpreted the data. Experiments and data acquisition were performed by C.G.G., B.T., C.H., J.B., P.S., A.K. and J.P.H. C.S. performed live cell imaging and evaluation of scratch closure assays. A.T. helped with immunofluorecsence microscopy. J.E.C., A.S.L.T. and S.L.I.J.D. conducted metagenomics analysis of wound microbiota. P.H. and M.W. produced calcipotriol ointment. A.D. and M.L. supervised single-patient observation using calcipotriol ointment. P.S. helped with immunofluorescence and Western blot analysis. C.G.G. and J.P.H. wrote the manuscript and prepared all figures. D.S., J.W.B. and J.R. gave scientific advice and helped with critical revision of the manuscript. The manuscript has been read and approved by all listed authors.
Corresponding author
Ethics declarations
Competing Interests
The authors declare no competing interests.
Additional information
Publisher's note: Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Electronic supplementary material
Rights and permissions
Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
About this article
Cite this article
Guttmann-Gruber, C., Tockner, B., Scharler, C. et al. Low-dose calcipotriol can elicit wound closure, anti-microbial, and anti-neoplastic effects in epidermolysis bullosa keratinocytes. Sci Rep 8, 13430 (2018). https://doi.org/10.1038/s41598-018-31823-6
Received:
Accepted:
Published:
DOI: https://doi.org/10.1038/s41598-018-31823-6
Comments
By submitting a comment you agree to abide by our Terms and Community Guidelines. If you find something abusive or that does not comply with our terms or guidelines please flag it as inappropriate.